Overview
NameMa00_p03020.1
Unique NameMa00_p03020.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length472
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:24506914..24508332 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa00_g03020~ Arogenate dehydratase/prephenate dehydratase 6, chloroplastic~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103974533
GenbankXM_009389388.1
EC4.2.1.91
EC4.2.1.51
InterProIPR001086
InterProIPR018528
InterProIPR002912
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03020.1 ID=Ma00_p03020.1|Name=Ma00_p03020.1|organism=Musa acuminata|type=polypeptide|length=473bp
MYMSTMAAVMLSSAPRHVLSPIFPPPDNHVPPPTALPKRGPAFRRLPSAV
LRSAIRSIYVPESTSAAPFPGALGSSRSDWQTNCAILASKAASNSSSSSS
SGGDNAGAASNEPRSSNDGNHYHLTSPTPVNGLKQNSATLDLVPVANLPR
PLSISDLSPSPKHGSSVRVAYQGVPGAYSEAAAGKAYPNCEAIPCDQFEV
AFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHC
LLALPGVRKEQLTRVISHPQALSQCELTLTGMGLNVAREAFDDTAGAAEY
VANNGLRDTAAIASARAAELYKLQVLADGIQDDSGNVTRFVMLAREPIIP
RTDRPFKTSIVFAHDREGTSVLFKVLSAFAFRDISLTKIESRPHRHRPLR
LVDDANVGTAKHFEYMFYVDFEASMAETRAQKALAEVQEYTSFLRVLGSY
PMDMTPWDASSSPSPPTPPSSS*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03020.1Ma00_t03020.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Arogenate dehydratase/prephenate dehydratase 6, chloroplasticArogenate dehydratase/prephenate dehydratase 6, chloroplastic
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0004664prephenate dehydratase activity
GO:0016597amino acid binding
Vocabulary: Biological Process
TermDefinition
GO:0009094L-phenylalanine biosynthetic process
GO:0008152metabolic process