Overview
NameMa00_p02970.1
Unique NameMa00_p02970.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length353
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:22703222..22705354 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa00_g02970~ BTB/POZ and TAZ domain-containing protein 2~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103974287
GenbankXM_009389073.1
InterProIPR000197
InterProIPR000210
InterProIPR011333
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p02970.1 ID=Ma00_p02970.1|Name=Ma00_p02970.1|organism=Musa acuminata|type=polypeptide|length=354bp
MTASVTHRNGLIRRWHEAGNECVPPTDVQIVTSDGKSIPAHSSVLASASP
VLERMLDRSRKGGNSERIIHVLGVPHDAVLVFLQFLYSSGTGMWSREAEE
EMERHGMALLALSHAYRVRWLKRRCEAGVAAWLSAVKVMDVLKLARLCDA
PRLYQRCMRLVAKDLEAVQQSEGWRFVQKHDPGLETEVLQLLQETSQRGK
RWRRERGDQDKYRQLSEAMDCLQHICTEGCTDVGPHNSRPPAYPCTSFST
CEGLQLLIRHFAACGRKLSPKGCTHCKRMWQLLRLHSSLCDQPDSCRVPL
CEQFKKKVQEEKVDRTWRLLVKKVATARVMSSLANRKVPEIVQKSRVRYR
GTR*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t02970.1Ma00_t02970.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
BTB/POZ and TAZ domain-containing protein 2BTB/POZ and TAZ domain-containing protein 2
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0003712transcription cofactor activity
GO:0004402histone acetyltransferase activity
GO:0008270zinc ion binding
GO:0005515protein binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus