Overview
NameMa00_p02900.1
Unique NameMa00_p02900.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length148
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:22633920..22634780 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT17010_001
Old locus tagGSMUA_AchrUn_randomG17010_001
Color6
NoteMa00_g02900~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ8H2A7
TrEMBLQ6ZH84
TrEMBLC5YAQ2
TrEMBLC5XWH2
TrEMBLC0PDQ4
TrEMBLB9IEZ0
TrEMBLB8K1X5
TrEMBLA2X6P6
TIGROs10g25120.1
TIGROs04g40090.1
TIGROs02g38050.6
TIGROs02g38050.5
TIGROs02g38050.4
TIGROs02g38050.3
TIGROs02g38050.2
TIGROs02g38050.1
SwissProtQ9H6K1
SwissProtQ5RC94
SwissProtQ5F3N9
SwissProtQ5BL31
SwissProtQ501R9
SwissProtQ3TT38
SwissProtQ14596
SwissProtP97432
GreenPhylGP002561
InterProIPR032350
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p02900.1 ID=Ma00_p02900.1|Name=Ma00_p02900.1|organism=Musa acuminata|type=polypeptide|length=149bp
MCNAIHTFNCLIMLFTTSDLLTSFTWFWCEAIKTKIRKLLYQNITVLDGT
LMPPSTRFTKIWRMQNNGTTRWPYRTKLVWAGGDKFANKDYFDVAVDLTS
PAVPCLVGIFHIGDWRHLLVKCLDNEFGFILRWISLNQTLLLEVSILI*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t02900.1Ma00_t02900.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene