Overview
NameMa00_p02850.5
Unique NameMa00_p02850.5
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length543
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:22478158..22486742 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
NoteMa00_g02850~ Metal transporter Nramp3~ unknown_gene~ complete
Color6
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103974676
GenbankXM_009389549.1
InterProIPR001046
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p02850.5 ID=Ma00_p02850.5|Name=Ma00_p02850.5|organism=Musa acuminata|type=polypeptide|length=544bp
MEMSGSQPSQFITSNGSRGISRGSGTPLIDDIEMGQIIVPERKSWKNLFA
YMGPGFLVSIAYIDPGNFETDLQAGAQFTYELLWIILLASCSALVIQSLA
AKLGVVTGKHLAEHCRAEYPKIPNFILWVLAELAVVACDIPEVIGTAFAL
NMLFKIPVWCGVLLTGLSTLLLLLLQQYGVRKLEFFIAFLVLTMAGCFFA
ELGYAKPKSSEVLKGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALV
LSRKIPRSIHGIKEACRFYIIESAFALAVAFLINVSVISVSGAVCSSEGL
NPEDQRNCSDLDLNKASFLLRNVLGNWSSKLFAIALLASGQSSTITGTYA
GQYVMQGFLDLRITPWIRNLLTRSLAIVPSLIVALIGGSTAAGKLIIIAS
MILSFELPFALVPLLKFTSSKTKMGSHANSLMIAATTWIISSLIVIINTY
YLVTGFINLLLHSGLHTVSIAFAGVFGFSGMLVYVAAILYLVFRTNRKST
QPLLHDDSQFGQTCESNNGIYDLPREDIASMQLPQGRSTSDLD*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t02850.5Ma00_t02850.5Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Metal transporter Nramp3Metal transporter Nramp3
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0005215transporter activity
Vocabulary: Biological Process
TermDefinition
GO:0006810transport
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane