Overview
NameMa00_p02430.1
Unique NameMa00_p02430.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length1038
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:17741388..17744582 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
NoteMa00_g02430~ Putative Uncharacterized mitochondrial protein AtMg00860~ unknown_gene~ modules
Color6
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103974602
GenbankXM_009389455.1
InterProIPR012337
InterProIPR000477
InterProIPR021109
InterProIPR002156
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p02430.1 ID=Ma00_p02430.1|Name=Ma00_p02430.1|organism=Musa acuminata|type=polypeptide|length=1039bp
MRSPRELADRSKYCRFHRQPGHDTEECRELKRQIEELIRRGHLGSYLRPD
KELSPRPEGPIERHIEVITGGPTSGGSSMAGGRAYARASRAEASKPAKGP
EVTFPTGEPEPPEHDDALVISARIANAQVGRIMVDTGSSADILYWDAFQK
LGLVKENMKPVCSTLTGFTGASISSLGVITLPLTLGVFPKAKTVMTSFLV
VDLPTAYNAILGRPTLNKTRAVISTYYQTIKFPTHDGVGEVAGNSWESRR
CYLTAVSLNKRARVQSPLEDPREGKKPTPRPEPKESTIDLPLIEGRPDQT
VKIGSGLPEQEQRQLVGLLQANADIFAWTPADLAGVHPEVALHHLNISSD
ARPVKQRPRRQAPDRQLAIREEVNRLLATGFIEEASLNNACPKDCYPLPK
IDQLVDATAGHARLSFMDAFSGYNQIRMAPEDQEHTAFLTEQGIYFYKVM
PFGLKNAGATYQRTVNRMFAHQIGRNMEVYIDDMIVKSRTAETHPSDLAE
TFDTLRKFGLRLNPAKCAFGVTSEKFLGFIIHERGIDANPEKIQAIINMQ
PPRTIRDLQRLNGRLVALSRFLSRSGDRCHPFFQALKDPKNFRWTAECEG
AFEQMKLHLASLPRLASVSPGEKLSLYLAASRHAVSSVLVKENSGDQLPV
YYVSHMLSGPEERYPPIEKLALALVLSARKLRPYFQAHPIEVITDQPLRL
VLSKFDVAGRLLKWAVELGEHDIQYMPRTAIKAQSVADFIAELTPNTGEE
LEPPRDTWTLHVDGSANAKGAGAGLVLVTPDGRSIERSLRFGFRATNNEA
EYEALLAGLQLALEMQVTDIRVITDSQLVARQLDGEYEARDPTMAKYLAQ
VKSLAAKFACFELSNVPRSENQRADTLAKLASGPAPWARPETEELPRRAI
EVVATVAHGTPATWVQEMLRFKRDGTLPDDPTTARRLRRTQAWYTEEGGR
LYKQSFSRPLLRCLEPSEAWTVLSDMHEGACGEHMGERALAHKVLQQGYY
WPTMRQDAKAFVRRCSSCQEHARTARRPAVLFTPVDCA*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t02430.1Ma00_t02430.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
modulesmodules
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_3IC_3
Vocabulary: Genedb Products
TermDefinition
Putative Uncharacterized mitochondrial protein AtMg00860Putative Uncharacterized mitochondrial protein AtMg00860
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0004523RNA-DNA hybrid ribonuclease activity