Overview
NameMa00_p02120.1
Unique NameMa00_p02120.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length63
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:15340002..15340193 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_Achr1T27670_001
Old locus tagGSMUA_Achr1G27670_001
NoteMa00_g02120~ Cell division cycle 20.1, cofactor of APC complex~ unknown_gene~ fragment
Color6
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ9SZA4
TrEMBLQ8GY38
TrEMBLD7M8S7
TrEMBLD2U579
TrEMBLB9SDP0
TrEMBLB9S1Y4
TrEMBLB6U240
TrEMBLA5BP73
TIGROs09g06680.1
TIGROs04g51110.2
TIGROs04g51110.1
TIGROs03g03150.2
TIGROs03g03150.1
TIGROs02g47180.2
TIGROs02g47180.1
TIGROs01g74146.1
SwissProtQ9UM11
SwissProtQ9R1K5
SwissProtQ9JJ66
SwissProtQ8VZS9
SwissProtQ8LPL5
SwissProtQ8L3Z8
SwissProtQ5H7C0
SwissProtQ12834
InterProIPR019775
InterProIPR017986
GreenPhylGP000698
InterProIPR015943
InterProIPR001680
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p02120.1 ID=Ma00_p02120.1|Name=Ma00_p02120.1|organism=Musa acuminata|type=polypeptide|length=64bp
MTRKAELFGHSSRVLYLVGSPLGGVVASAAEDETLKFWNVFETPKPPKPE
ASTVPFAQFSVIR*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t02120.1Ma00_t02120.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Cell division cycle 20.1, cofactor of APC complexCell division cycle 20.1, cofactor of APC complex
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding