|
|
Overview
| Name | Ma00_p02020.1 |
|---|
| Unique Name | Ma00_p02020.1 |
|---|
| Type | polypeptide |
|---|
| Organism | Musa acuminata (musa) |
|---|
| Sequence length | 107 |
|---|
Alignments
The following features are aligned
| Aligned Feature | Feature Type | Alignment Location |
|---|
| chrUn_random | chromosome | chrUn_random:14301656..14304888 - |
Analyses
This polypeptide is derived from or has results from the following analyses
| Analysis Name | Date Performed |
|---|
| manual_curation | 2015-04-05 .281687 |
Properties
| Property Name | Value |
|---|
| Date | Tue Dec 7 21:17:29 CET 2010 |
| Inference | {gaze} |
| Alternative splicing | to_fill |
| Owner | musa |
| Annotator comment | to_fill |
| Origin | CIRAD:GSMUA_AchrUn_randomT05600_001 |
| Old locus tag | GSMUA_AchrUn_randomG05600_001 |
| Color | 6 |
| Note | Ma00_g02020~ Uncharacterized protein~ unknown_gene~ complete |
Cross References
External references for this polypeptide
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ma00_p02020.1 ID=Ma00_p02020.1|Name=Ma00_p02020.1|organism=Musa acuminata|type=polypeptide|length=108bp
MPYKENQQLQVKNPYMGVISLWTNRRSQTFQSSVGRRRLFSFLLVPEELP
LIRLLRSLAAVFLLLLSLLLELCGMVQQLPQSHSLVPLVISGSGRLSAIN
QYIEEAG* back to top
Relationships
This polypeptide derives from the following mRNA feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
| Term | Definition |
|---|
| complete | complete |
Vocabulary: CC Evidence
| Term | Definition |
|---|
| automatic | automatic |
Vocabulary: CC Status
| Term | Definition |
|---|
| in_progress | in_progress |
Vocabulary: CC Evidence Code
| Term | Definition |
|---|
| IC_1 | IC_1 |
Vocabulary: Genedb Products
| Term | Definition |
|---|
| Uncharacterized protein | Uncharacterized protein |
Vocabulary: CC EC Number
| Term | Definition |
|---|
| no_EC_number | no_EC_number |
Vocabulary: CC Gene
| Term | Definition |
|---|
| unknown_gene | unknown_gene |
|