Overview
NameMa00_p01620.1
Unique NameMa00_p01620.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length228
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:9872790..9873932 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT01310_001
Old locus tagGSMUA_AchrUn_randomG01310_001
Color6
NoteMa00_g01620~ Putative Cinnamate beta-D-glucosyltransferase~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLC5Z8I9
TrEMBLC5XX08
TrEMBLC5XP84
TrEMBLC4MF33
TrEMBLB9RY86
TrEMBLB9RY84
TrEMBLB6TZ09
TrEMBLB6SU66
TIGROs09g34250.1
TIGROs09g34230.1
TIGROs05g47950.1
TIGROs04g12980.1
TIGROs03g48740.1
TIGROs02g09510.1
TIGROs01g49240.1
TIGROs01g49230.1
SwissProtQ9ZVY5
SwissProtQ9SK82
SwissProtQ9MB73
SwissProtQ9LR44
SwissProtQ41819
SwissProtQ0WW21
SwissProtP0C7P7
SwissProtO48676
InterProIPR002213
GreenPhylGP000013
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t01620.1Ma00_t01620.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p01620.1 ID=Ma00_p01620.1|Name=Ma00_p01620.1|organism=Musa acuminata|type=polypeptide|length=229bp
MPLLRATGPPALADLIRRHVDAGRPVSCVVNNPFLPWVLDVAADLGIPSG
VLWVQSCAAQELPSFLLPSSPYKVLAKAILEQFANISKASWVLAKSFEEL
EHEAIDAISHRLPFIPAPLSVVYVSVGSVAAAEPGLVVAWSPQDRVLAHP
AIACFVTHCGWNSTLEALTAGVPVVTYPQWGDQVPGSKFLVEVYGVGGGS
SDRHIQAFVDEIRKRAPGGGHVDSDGTI*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_3IC_3
Vocabulary: Genedb Products
TermDefinition
Putative Cinnamate beta-D-glucosyltransferasePutative Cinnamate beta-D-glucosyltransferase
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0016758transferase activity, transferring hexosyl groups