Overview
NameMa00_p01580.1
Unique NameMa00_p01580.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length164
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:9737840..9738917 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT28450_001
Old locus tagGSMUA_AchrUn_randomG28450_001
Color6
NoteMa00_g01580~ glycerophosphoryl diester phosphodiesterase family protein, putative, expressed~ unknown_gene~ fragment
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ6ZIM6
TrEMBLQ6ZIM5
TrEMBLD7SSP5
TrEMBLD7MPL3
TrEMBLB9IMG5
TrEMBLB9HAR2
TrEMBLB9F3R4
TrEMBLB8AJ79
TIGROs12g27102.1
TIGROs09g17000.2
TIGROs08g39350.1
TIGROs04g39610.1
TIGROs03g40670.1
TIGROs02g37590.1
TIGROs02g09450.3
TIGROs02g09450.1
SwissProtQ9SZ11
SwissProtQ9FJ62
SwissProtQ7Y208
SwissProtP96236
SwissProtP54527
SwissProtP37965
SwissProtP09394
SwissProtB7VJ87
InterProIPR017946
InterProIPR004129
InterProIPR001711
GreenPhylGP000005
InterProIPR030395
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t01580.1Ma00_t01580.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p01580.1 ID=Ma00_p01580.1|Name=Ma00_p01580.1|organism=Musa acuminata|type=polypeptide|length=165bp
MRLNVFLLILLLHGAAAVKPPAKWQTLSGEAPVVVARGGFSGIFPESSQY
AYQIAESTSLKNVVLLCDLQLTKDGGGICQSDLRLDNSTTISSVFPKGQK
TYSVNGQPLTGWFSVDFTSDQIYNNVSCEYTSFCSFSGFYSVYLTGSSDK
EEIYNNFWLIFMWL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
glycerophosphoryl diester phosphodiesterase family protein, putative, expressedglycerophosphoryl diester phosphodiesterase family protein, putative, expressed
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0008889glycerophosphodiester phosphodiesterase activity
GO:0008081phosphoric diester hydrolase activity
GO:0004435phosphatidylinositol phospholipase C activity
Vocabulary: Biological Process
TermDefinition
GO:0007165signal transduction
GO:0006629lipid metabolic process
GO:0006071glycerol metabolic process
GO:0035556intracellular signal transduction