Overview
NameMa00_p01540.1
Unique NameMa00_p01540.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length556
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:9549372..9557223 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
NoteMa00_g01540~ Putative Subtilisin-like protease SBT1.2~ unknown_gene~ fragment
Color6
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103972872
GenbankXM_009387251.1
InterProIPR000209
InterProIPR015500
InterProIPR003137
InterProIPR023827
InterProIPR010259
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t01540.1Ma00_t01540.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p01540.1 ID=Ma00_p01540.1|Name=Ma00_p01540.1|organism=Musa acuminata|type=polypeptide|length=557bp
MSLSKHALSLVLYLCASFLRSGLHVDGSEEPKAYIVHVKGPEKMDFDVAD
QWSEWYSSLLESAATPLGLESEEGDPRSRLIYSYRNVMTGFAARLTPREV
EAMSTMDWFLHAYPSRVYRLKTTHTPEFLGLRLGVWNESNMGEGIIIGLL
DTGVTPGHPSYDDHGMPPPPAKWKGRCDLKASACNNKLIGARSFINHDGR
DRRSTGTPVDEEGHGTHTSSTAAGAFVKRANVNGFAPGVAAGMAPRAHIA
AYKVCDEIACMGHDMLAAMDAAVDDGVDVLSFSISADPIPFHSDPIAQGT
FNAIGKGVFISCSAGNEGPDPGSVNNDAPWVLTVGASTTDRLFLASVKLG
NGRKLYGESLHRPRSFNPKMLPLVYPGFVTAKDGAYMCINGTLDGVDVRG
KLVLCQLGVIDSVQMSEVVKKAGGAGMIVMNYPVDGYTIIADDHVLPTSM
VPYAYGLEIQAYINSTSTPIANIIYHAKEVSNWEAKVEAQGVKKYKALRD
FKKGLARLRHNSLAFGYDLAMSRAKYDHPDIELPENPIDKRPTNDEVMIS
SSDIVD*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_3IC_3
Vocabulary: Genedb Products
TermDefinition
Putative Subtilisin-like protease SBT1.2Putative Subtilisin-like protease SBT1.2
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0004252serine-type endopeptidase activity
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis