Overview
NameMa00_p01000.1
Unique NameMa00_p01000.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length828
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:3684195..3694368 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa00_g01000~ Phosphatidylinositol 4-phosphate 5-kinase 9~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103972981
GenbankXM_009387408.1
EC2.7.1.68
InterProIPR003409
InterProIPR017163
InterProIPR023610
InterProIPR027483
InterProIPR002498
InterProIPR027484
InterProIPR016034
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p01000.1 ID=Ma00_p01000.1|Name=Ma00_p01000.1|organism=Musa acuminata|type=polypeptide|length=829bp
MSLPGAHVDDVERLSCCRGSSHDTGCIDDKGLSVHLFNSQDTLASSSYVS
FRVTEVTLPSGDKYCGTLLGNVPEGSGKYVWSNGCTYEGEWRRGMRHGHG
KIMWSSGAVYDGEFSGGYMHGNGTYSGPDNLTYKGRWKLNLRHGLGYQTY
PNGDIFEGSWIQGVIEGHGKYAWANENMYIGNMKGGKMSGKGTFTWKNGD
SYEGNWLDGMMHGFGVYTWVDSGCYVGTWTRGLKDGKGFFYPHGSKIPAG
QELYLNALRKRGLLPDFKRQNHGSRILHASSVDMGNMKVGETRESGNVPT
ISVPKGHLINFEQSRAKHVSLERRWSLEVAIEKVIGHDMTLESVAESDEK
AVDTNVPILEREYMQGVLISEVVISNSFLMSPRKAKRRQKRLMKEIKKPG
EAIIKGHRSYDLMLSLQLGIRYTVGKITPIQRREVRASDFGPRASFWMNF
PKEGSQLTPPHRAEDFKWKDYCPMVFRNLREMFKIDAADYMMSICGSAAL
RELSSPGKSGSIFFLSQDDRFMIKTLRKSEVKVLLRMLPNYYHHVRTYEN
TLITKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIHRRFDLKGSSLGRST
DNVEIDENTTLKDLDLDYCFYLEPSWRDALLKQIEIDSKFLETQRIMDYS
LLLGVHYRAPRHLQSYVSFHQNVTADGLTARPEEDTQEDEIFNYPQGLVL
VPRVSDGNSVVVGPHIRGSRLRASAAGFVEVDLLLPGTARLQIQLGVNMP
ARAEHIPRDDGTELIHEVYDVVLYLGIIDILQEYNMTKKIEHAYKSLQFD
SISISAVDPEFYSQRFLKFIQTVFPENA*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t01000.1Ma00_t01000.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Phosphatidylinositol 4-phosphate 5-kinase 9Phosphatidylinositol 4-phosphate 5-kinase 9
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:00163081-phosphatidylinositol-4-phosphate 5-kinase activity
GO:0016307phosphatidylinositol phosphate kinase activity
Vocabulary: Biological Process
TermDefinition
GO:0046488phosphatidylinositol metabolic process