Overview
NameMa00_p00960.1
Unique NameMa00_p00960.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length66
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:3529189..3529918 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT02580_001
Old locus tagGSMUA_AchrUn_randomG02580_001
NoteMa00_g00960~ Uncharacterized protein~ unknown_gene~ complete
Color6
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ9C6V6
TrEMBLQ8RWS4
TrEMBLQ6EQN5
TrEMBLC5YAL4
TrEMBLB9RQ30
TrEMBLB9N651
TrEMBLB4G093
TrEMBLA9PBD7
TIGROs09g18320.1
TIGROs03g39790.1
TIGROs01g20040.1
InterProIPR007955
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p00960.1 ID=Ma00_p00960.1|Name=Ma00_p00960.1|organism=Musa acuminata|type=polypeptide|length=67bp
MFYRTCSMIMVCYNHLFKKHHLVTPEICRKLKNSWNHGEEDDPMATYILV
SVEDRWDFPEVPMVED*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t00960.1Ma00_t00960.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene