Overview
NameMa00_p00950.1
Unique NameMa00_p00950.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length248
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:3525528..3529152 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
NoteMa00_g00950~ Uncharacterized protein~ unknown_gene~ complete
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT02570_001
Old locus tagGSMUA_AchrUn_randomG02570_001
Color6
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ6EQN5
TrEMBLD7TP85
TrEMBLD7SRQ3
TrEMBLB9RQ30
TrEMBLB9N651
TrEMBLB9I1W1
TrEMBLB8BER5
TrEMBLA9PBD7
TIGROs12g06230.1
TIGROs09g18320.1
TIGROs05g18540.1
TIGROs04g29870.1
TIGROs01g74010.2
TIGROs01g74010.1
TIGROs01g21210.1
SwissProtQ80WL2
SwissProtQ5E9N0
SwissProtQ20932
SwissProtQ13895
SwissProtP51406
SwissProtO54825
SwissProtA9UNU6
SwissProtA7S7F2
InterProIPR007955
GreenPhylGP001769
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p00950.1 ID=Ma00_p00950.1|Name=Ma00_p00950.1|organism=Musa acuminata|type=polypeptide|length=249bp
MLCHFTVDLIPKLRDPEGSRQPAEGNPPGSGGRELHPLSAVAVDPSVALN
NDAEDVDEFDGFSETQSRYDGGEVEIDEEDEKVMAAFMSTKSGRSSHWRT
SSFRGSKRRKRRSLLNNLSLNWIVASLICIRGYTALRKSVYKPAAFFKGV
LLSLCQSGTCTLQEAVIIGSIIQKVSIPPLHSTAALMKLAELDYCGTTSY
FINPFLGKKYALPYRVLDVVVAHFMRCLEDTRIMPVIWHQLVLAFVQR*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t00950.1Ma00_t00950.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene