Overview
NameMa00_p00910.1
Unique NameMa00_p00910.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length209
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:3482450..3484565 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT02530_001
Old locus tagGSMUA_AchrUn_randomG02530_001
Color6
NoteMa00_g00910~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ8L7M7
TrEMBLQ6K7Q5
TrEMBLQ56WK3
TrEMBLD7T7C1
TrEMBLB9SI48
TrEMBLB9N9I9
TrEMBLB9N7Z3
TrEMBLB8AF64
TIGROs05g38400.1
TIGROs03g06180.1
TIGROs02g58110.1
SwissProtQ8IWB9
SwissProtQ6ZPJ0
SwissProtQ6CAP9
SwissProtQ5KCS3
SwissProtQ06833
SwissProtP77439
SwissProtO94464
SwissProtB6K6N3
GreenPhylGP003071
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p00910.1 ID=Ma00_p00910.1|Name=Ma00_p00910.1|organism=Musa acuminata|type=polypeptide|length=210bp
MFVFTQRYMHKYCYSDGLRNSKSASWTSGHVSRWKAILHSLANQVSQVPL
SLSIRVISLRGTLRLYIKPPPSDQLWFGFTTMPELDWNLESSVGDRKITS
SHIALLISNRFKAAIRDSLVLPNCETICIPWMLAEKDDWVPRKVAPFMWI
NNENTEMTWPEFPVPHNREDKPKLDGSNKTKDSLDDKVDEAKNVIHVEQP
ALQFSCIDV*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t00910.1Ma00_t00910.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene