Overview
NameMa00_p00900.1
Unique NameMa00_p00900.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length260
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:3364028..3368195 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
NoteMa00_g00900~ 20 kDa chaperonin, chloroplastic~ unknown_gene~ complete
Color6
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103968424
GenbankXM_009381652.1
InterProIPR020818
InterProIPR018369
InterProIPR011032
InterProIPR017416
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p00900.1 ID=Ma00_p00900.1|Name=Ma00_p00900.1|organism=Musa acuminata|type=polypeptide|length=261bp
MASLQLAGTGNPAVARRSLPSFHGLRLSPFPFRLPSSIGACGVALERRGF
RGHVVKAATVVAPKYISVKPLGDRVLVKINTSEEVTVGGILLPTTAQSKP
QAGEVVAVGDGRTIGDDKVQIGIQTGSQVVYSKYAGTELEFNGSNHVILK
EDDIVGILEADDVKDLKPLNDRVLIKVAEAEEKTAGGLLLTEASKEKPSI
GTVIAVGPGPLDEEGNRKPSTTITPGSTVLYSKYAGNEFKSADGSLYIAL
RASDVMAVLS*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t00900.1Ma00_t00900.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
20 kDa chaperonin, chloroplastic20 kDa chaperonin, chloroplastic
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Biological Process
TermDefinition
GO:0006457protein folding
GO:1901671positive regulation of superoxide dismutase activity
Vocabulary: Cellular Component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0046914transition metal ion binding