Overview
NameMa00_p00850.1
Unique NameMa00_p00850.1
Typepolypeptide
OrganismMusa acuminata (DH Pahang)
Sequence length457
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:3243364..3244737 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa00_g00850~ Putative pentatricopeptide repeat-containing protein At4g17915~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103968406
GenbankXM_009381619.1
InterProIPR002885
InterProIPR011990
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p00850.1 ID=Ma00_p00850.1|Name=Ma00_p00850.1|organism=Musa acuminata|type=polypeptide|length=458bp
MIRRLSTKLLNVCVSSLCKARNLDKAEAVIIDGIRLGCLPDVVTYNTLID
AYCCLVGIDEAYVILYRMREAGVRPDVITYNSLIAGATRCCLPTRSLDLF
EEMLQAGLVPDVWTYNTLMHCLFKCGYPEDAYKIYLDMISKNVTPSLTTY
NTLINGMCKTGNAMSGLRLFRNLERLGFSAELVTYNTIINGLCKSGRIGE
ARRILKELGESDCVPNEITYTTVMKCCFQNGRFEQGFEIFYGMMNKGYTA
DVFAYCAAISALIKMGNLEDANACVEQMLRNGIGLDKACYNTIIYLQCKE
GKLDYAFQLVNEMEEAGLGSDQYTYSILIDGLCRMGYIDSANKQLHMMEM
RGFRSNLVAYNCLIDGLCKLGEVDLALKLFHEMKSKDNYTYTSIVNGLCK
KSRFHAASKLLLNCLKEGSSVLTSTHRAVIAGLQSAGFRRDAKRLRASLR
VACLLRY*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t00850.1Ma00_t00850.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_3IC_3
Vocabulary: Genedb Products
TermDefinition
Putative pentatricopeptide repeat-containing protein At4g17915Putative pentatricopeptide repeat-containing protein At4g17915
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding