Overview
NameMa00_p03340.1
Unique NameMa00_p03340.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length161
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:28321217..28321963 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT15120_001
Old locus tagGSMUA_AchrUn_randomG15120_001
Color6
NoteMa00_g03340~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ6H7I7
TrEMBLQ6H7I6
TrEMBLQ1EP77
TrEMBLC5XY68
TrEMBLB9H5R1
TrEMBLB8AFT0
TrEMBLB6UB57
TrEMBLB4G126
TIGROs06g51370.1
TIGROs02g55130.4
TIGROs02g55130.2
TIGROs02g55130.1
TIGROs02g42310.4
TIGROs02g42310.3
TIGROs02g42310.2
TIGROs02g42310.1
SwissProtQ9ZQQ0
SwissProtQ9SFB5
SwissProtQ9M099
SwissProtQ9LEY1
SwissProtQ8L9Y0
SwissProtQ0WPR4
SwissProtP08819
SwissProtO82229
InterProIPR001563
GreenPhylGP000047
InterProIPR029058
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03340.1 ID=Ma00_p03340.1|Name=Ma00_p03340.1|organism=Musa acuminata|type=polypeptide|length=162bp
MPAIYDTCVPDYTEAFFNRADVQKALHANVTNLSYNWTYCSNVLTSWSDA
PFSMLPTIKKLVDGGIRVWVFRVPVTSTRYALNKLRLDTVEEWTPWYSDK
QVGGWRVIYDGLTFVTVPPGMMFPRSSRRKHSNSSGTSCPTSSCLWSHVS
SCCRTLSPSSK*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03340.1Ma00_t03340.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
Vocabulary: Molecular Function
TermDefinition
GO:0004185serine-type carboxypeptidase activity