Overview
NameMa00_p03320.1
Unique NameMa00_p03320.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length56
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:28185474..28185722 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT27370_001
Old locus tagGSMUA_AchrUn_randomG27370_001
Color6
NoteMa00_g03320~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLD8TR46
TrEMBLB8MBJ9
TIGROs04g25680.1
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03320.1 ID=Ma00_p03320.1|Name=Ma00_p03320.1|organism=Musa acuminata|type=polypeptide|length=57bp
KSEDAGGGPGKSYLFCLTAHAPWKRLSRRTECRPRPVVLITASGLQGEQP
LAHGTM*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03320.1Ma00_t03320.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene