Overview
NameMa00_p03280.1
Unique NameMa00_p03280.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length94
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:28158054..28158338 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT22450_001
Old locus tagGSMUA_AchrUn_randomG22450_001
Color6
NoteMa00_g03280~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLD8QJP1
TrEMBLA9U7C6
TrEMBLA9U701
TrEMBLA9U6L7
TrEMBLA9U5X4
TrEMBLA9U5I5
TrEMBLA7T6D5
TrEMBLA7T247
TIGROs02g58139.2
TIGROs02g58139.1
TIGROs02g10160.1
SwissProtQ8TGM5
SwissProtA9NEF4
GreenPhylGP000676
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p03280.1 ID=Ma00_p03280.1|Name=Ma00_p03280.1|organism=Musa acuminata|type=polypeptide|length=95bp
MSCSTTTDGSLFGQPHLPTWGAIIHVRPHPPRGQRRSVESMMPRQACPNR
MASGATCVQRLDGSRDSAIHTRYRISLRSSSMREPRYPLPRVIQ*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t03280.1Ma00_t03280.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene