Overview
NameMa00_p02140.1
Unique NameMa00_p02140.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length536
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
NoteMa00_g02140~ Probable monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic~ unknown_gene~ complete
Color6
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103974570
GenbankXM_009389426.1
EC4.1.99.12
EC3.5.4.25
InterProIPR016299
InterProIPR017945
InterProIPR000926
InterProIPR000422
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:15756924..15759114 -
Relationships

This polypeptide is derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t02140.1Ma00_t02140.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p02140.1 ID=Ma00_p02140.1|Name=Ma00_p02140.1|organism=Musa acuminata|type=polypeptide|length=537bp
MDCLLLSFPFSPQTIISSSCHPTFIGIHNLSYGLIKKGWSRLGCRSIGGS
GTEGAEWLDGGSPKGNDNGSVVGGLDGSRSAFSTLNAEITQETVDFFVSD
AEGDPDQPSKGFCSIDQAINALREGKFVIAVDDDDDDGENEGDLIMAATL
ANTKAIAFMMKHGSGIVSVGMKEEDLERLMIPMMSPITEIKDLSAAAATI
TVDARTTSSGVSAADRAETILALASPDSKPGDFRRPGHVFPLKYRNGGVL
KRAGHTEASVDLVTFAGLRPASILSTIIDPEDGSMAGLPTLRMLAKEYDL
PVISISDLIRYRRKREKLVEKIAVSRLPTKWGLFQAYCYQSKLDGTEHIA
VVKGDIGDGQNVLVRVHSECLTGDILGSARCDCGNQLDLALRLIEQVGRG
VIVYLRGHEGRGIGLGHKLRAYNLQDQGHDTVEANLELGLAVDAREYGIG
AQILRDIGVRTMRFMTNNPAKFMGLKGYGLAVVGRVPVMSPITEENKRYL
ETKRTKMGHIYGSDLPGSSPEFLSSEADQANKENGS*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
CC_functional_completenesscomplete
Vocabulary: CC Evidence
TermDefinition
CC_evidenceautomatic
Vocabulary: CC Status
TermDefinition
CC_statusin_progress
Vocabulary: CC Evidence Code
TermDefinition
CC_evidence_codeIC_2
Vocabulary: Genedb Products
TermDefinition
genedb_productsProbable monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic
Vocabulary: CC EC Number
TermDefinition
CC_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
CC_geneunknown_gene
Vocabulary: Biological Process
TermDefinition
GO:0009231riboflavin biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0003935GTP cyclohydrolase II activity
GO:00086863,4-dihydroxy-2-butanone-4-phosphate synthase activity
InterPro Report