Overview
NameMa00_p02040.1
Unique NameMa00_p02040.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length42
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:15246555..15247648 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_Achr1T27640_001
Old locus tagGSMUA_Achr1G27640_001
Color6
NoteMa00_g02040~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ14DR9
TIGROs07g16370.3
TIGROs07g16370.2
TIGROs07g16370.1
TIGROs03g52340.1
SwissProtQ9V3A6
SwissProtQ9C7S7
SwissProtQ8R4A1
SwissProtQ8R2E9
SwissProtQ8R180
SwissProtQ86YB8
SwissProtQ7SEY9
SwissProtB6CVD7
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p02040.1 ID=Ma00_p02040.1|Name=Ma00_p02040.1|organism=Musa acuminata|type=polypeptide|length=43bp
MAYVGCEKCRLWENLQTQEIVWNMPNTTLAMMWSILKHKNIC*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t02040.1Ma00_t02040.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene