Overview
NameMa00_p02020.1
Unique NameMa00_p02020.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length107
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT05600_001
Old locus tagGSMUA_AchrUn_randomG05600_001
Color6
NoteMa00_g02020~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ4TB64
TrEMBLQ0YR33
TrEMBLB9SD21
TIGROs10g14040.1
TIGROs02g19860.1
TIGROs01g39420.1
SwissProtQ8KAY6
SwissProtQ66KG0
SwissProtQ3B6C3
SwissProtQ14562
SwissProtB4SC83
SwissProtB3EGV0
SwissProtA4SCU9
SwissProtA1BIY8
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:14301656..14304888 -
Relationships

This polypeptide is derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t02020.1Ma00_t02020.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p02020.1 ID=Ma00_p02020.1|Name=Ma00_p02020.1|organism=Musa acuminata|type=polypeptide|length=108bp
MPYKENQQLQVKNPYMGVISLWTNRRSQTFQSSVGRRRLFSFLLVPEELP
LIRLLRSLAAVFLLLLSLLLELCGMVQQLPQSHSLVPLVISGSGRLSAIN
QYIEEAG*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
CC_functional_completenesscomplete
Vocabulary: CC Evidence
TermDefinition
CC_evidenceautomatic
Vocabulary: CC Status
TermDefinition
CC_statusin_progress
Vocabulary: CC Evidence Code
TermDefinition
CC_evidence_codeIC_1
Vocabulary: Genedb Products
TermDefinition
genedb_productsUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
CC_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
CC_geneunknown_gene
InterPro Report