Overview
NameMa00_p02010.1
Unique NameMa00_p02010.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length169
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:14248183..14249697 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT05590_001
Old locus tagGSMUA_AchrUn_randomG05590_001
Color6
NoteMa00_g02010~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ6YTM5
TrEMBLQ67IL1
TrEMBLQ67II3
TrEMBLB3SGQ4
TrEMBLA0ARW3
TrEMBLA0ARV4
TrEMBLA0ART1
TrEMBLA0ARS8
TIGROs08g15248.1
TIGROs07g25004.1
TIGROs04g16854.1
TIGROs04g16742.1
TIGROs01g74610.1
SwissProtQ67IG8
SwissProtQ67ID9
SwissProtQ67ID0
SwissProtQ67IB2
SwissProtQ67IA9
SwissProtQ67IA6
SwissProtQ67IA3
SwissProtP0CD55
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p02010.1 ID=Ma00_p02010.1|Name=Ma00_p02010.1|organism=Musa acuminata|type=polypeptide|length=170bp
MLVTLILKHGKKRVRNVLCGANDFITIFARMLATITNRLSSYLLSRYTKR
DGIMEIALTSITVAIRFKPAPFHQWTPYSKVYEGVLQAHFDSFLSFGKHF
PGNLSYCLYRLVIRELSHLVSSSLALFFREGGLPIGFLIDALCLCLIQSF
ASLRGAFNNYIRLFDYIGF*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t02010.1Ma00_t02010.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene