Overview
NameMa00_p02010.1
Unique NameMa00_p02010.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length169
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT05590_001
Old locus tagGSMUA_AchrUn_randomG05590_001
Color6
NoteMa00_g02010~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ6YTM5
TrEMBLQ67IL1
TrEMBLQ67II3
TrEMBLB3SGQ4
TrEMBLA0ARW3
TrEMBLA0ARV4
TrEMBLA0ART1
TrEMBLA0ARS8
TIGROs08g15248.1
TIGROs07g25004.1
TIGROs04g16854.1
TIGROs04g16742.1
TIGROs01g74610.1
SwissProtQ67IG8
SwissProtQ67ID9
SwissProtQ67ID0
SwissProtQ67IB2
SwissProtQ67IA9
SwissProtQ67IA6
SwissProtQ67IA3
SwissProtP0CD55
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:14248183..14249697 -
Relationships

This polypeptide is derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t02010.1Ma00_t02010.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p02010.1 ID=Ma00_p02010.1|Name=Ma00_p02010.1|organism=Musa acuminata|type=polypeptide|length=170bp
MLVTLILKHGKKRVRNVLCGANDFITIFARMLATITNRLSSYLLSRYTKR
DGIMEIALTSITVAIRFKPAPFHQWTPYSKVYEGVLQAHFDSFLSFGKHF
PGNLSYCLYRLVIRELSHLVSSSLALFFREGGLPIGFLIDALCLCLIQSF
ASLRGAFNNYIRLFDYIGF*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
CC_functional_completenesscomplete
Vocabulary: CC Evidence
TermDefinition
CC_evidenceautomatic
Vocabulary: CC Status
TermDefinition
CC_statusin_progress
Vocabulary: CC Evidence Code
TermDefinition
CC_evidence_codeIC_1
Vocabulary: Genedb Products
TermDefinition
genedb_productsUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
CC_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
CC_geneunknown_gene
InterPro Report