Overview
NameMa00_p01950.1
Unique NameMa00_p01950.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length230
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
NoteMa00_g01950~ Dehydration-responsive element-binding protein 1C~ unknown_gene~ complete
Color6
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103999586
GenbankXM_009421371.1
InterProIPR001471
InterProIPR016177
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:13738365..13739057 +
Relationships

This polypeptide is derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t01950.1Ma00_t01950.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p01950.1 ID=Ma00_p01950.1|Name=Ma00_p01950.1|organism=Musa acuminata|type=polypeptide|length=231bp
MEAFSGDDAAAATVSGTKGTWLYATVSEAPPKRPAGRTKFRETRHPVYKG
VRQRGAAGRWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAAMMLRGRSA
CLNFADSAWRLRVPASFSCSQDIARAAAEAAEAFRPPSDSNATFESSLTM
ESSASTFPSLSPLATAATPSSVLLEDGIGSQEGVTFDMVSYDGMDLGYCD
YSGMAEGALVDSIWDDVAADADVSLWSYSI*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
CC_functional_completenesscomplete
Vocabulary: CC Evidence
TermDefinition
CC_evidenceautomatic
Vocabulary: CC Status
TermDefinition
CC_statusin_progress
Vocabulary: CC Evidence Code
TermDefinition
CC_evidence_codeIC_2
Vocabulary: Genedb Products
TermDefinition
genedb_productsDehydration-responsive element-binding protein 1C
Vocabulary: CC EC Number
TermDefinition
CC_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
CC_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0003700sequence-specific DNA binding transcription factor activity
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro Report