Overview
NameMa00_p01660.1
Unique NameMa00_p01660.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length147
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:9995191..9995736 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT26200_001
Old locus tagGSMUA_AchrUn_randomG26200_001
Color6
NoteMa00_g01660~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ9XIP6
TrEMBLQ9LIW7
TrEMBLD7T7L3
TrEMBLB9S250
TrEMBLB9I744
TrEMBLB9FGI8
TrEMBLB8AXC0
TrEMBLA2XZS2
TIGROs05g03120.2
TIGROs05g03120.1
TIGROs05g02820.1
TIGROs02g24270.1
TIGROs01g61760.4
TIGROs01g61760.3
TIGROs01g61760.2
TIGROs01g61760.1
SwissProtQ9ZQC5
SwissProtQ9C0C9
SwissProtQ6G0P2
SwissProtQ62868
SwissProtQ3U3N0
SwissProtQ2S307
SwissProtQ1JPB9
SwissProtP70336
GreenPhylGP000457
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p01660.1 ID=Ma00_p01660.1|Name=Ma00_p01660.1|organism=Musa acuminata|type=polypeptide|length=148bp
MWVCKKALIYLILNRSNLSVASNGNTTPAKSKGSKVVWNGSTESASVWFT
FSSEKGTFFLPNVSSPVLKSSSPVPKPHTFLKRPPKWVESKQPTKTSTSP
ENPQRTLKGSELQEKLDAIAEDLKKARAQLAFVELEKVQAIEELNES*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t01660.1Ma00_t01660.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene