Overview
NameMa00_p01630.1
Unique NameMa00_p01630.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length78
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:9873964..9874200 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT01320_001
Old locus tagGSMUA_AchrUn_randomG01320_001
NoteMa00_g01630~ Uncharacterized protein~ unknown_gene~ complete
Color6
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ9FYU7
TrEMBLD7U9I4
TrEMBLD7KF51
TrEMBLC1L322
TrEMBLB9RY87
TrEMBLB0I192
TrEMBLA6XNC4
TrEMBLA5AMB8
TIGROs09g34270.1
TIGROs05g47950.1
TIGROs04g12960.1
TIGROs03g48740.1
TIGROs02g09510.1
TIGROs01g66470.1
TIGROs01g49240.1
TIGROs01g49230.1
SwissProtQ9ZVY5
SwissProtQ9SK82
SwissProtQ9MB73
SwissProtQ9LR44
SwissProtQ8KAD1
SwissProtQ41819
SwissProtQ0WW21
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p01630.1 ID=Ma00_p01630.1|Name=Ma00_p01630.1|organism=Musa acuminata|type=polypeptide|length=79bp
MEGDSGSKCNMPHLLMVSFAAQGHLNPLLRQRPPRHPLLHRRHPPPDLLL
HRQRRPWRPHARRPWLHPLRVLLRQPGR*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t01630.1Ma00_t01630.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene