Overview
NameMa00_p01610.1
Unique NameMa00_p01610.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length88
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:9786945..9787211 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT01300_001
Old locus tagGSMUA_AchrUn_randomG01300_001
Color6
NoteMa00_g01610~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ7EZD3
TrEMBLD7TVV2
TrEMBLC5YHA7
TrEMBLC0PCI8
TrEMBLB9RYY3
TrEMBLB9I0P6
TrEMBLB9GJI4
TrEMBLB8BAW7
TIGROs08g06140.3
TIGROs08g06140.2
TIGROs08g06140.1
TIGROs04g38720.1
TIGROs02g36880.3
TIGROs02g36880.2
TIGROs02g36880.1
TIGROs01g15640.1
SwissProtQ9SV87
SwissProtQ9FWX2
SwissProtQ7GCL7
SwissProtQ52QH4
SwissProtQ39013
SwissProtO81914
SwissProtO81913
SwissProtO04017
InterProIPR003441
GreenPhylGP000020
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p01610.1 ID=Ma00_p01610.1|Name=Ma00_p01610.1|organism=Musa acuminata|type=polypeptide|length=89bp
MELPPGFRFRPTDAELVNHYLEEKIAGRIKSADEVISEIDICKSEPWDLP
GDLPAPKSYLLPLLHCLIHLFVCDLWSVFVFPIFFGKN*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t01610.1Ma00_t01610.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated