Overview
NameMa00_p01600.1
Unique NameMa00_p01600.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length139
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:9771979..9772398 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT01290_001
Old locus tagGSMUA_AchrUn_randomG01290_001
Color6
NoteMa00_g01600~ Uncharacterized protein~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ8NT49
TrEMBLD7TTE3
TrEMBLD2MJF0
TrEMBLC6TFH4
TrEMBLC6T2U6
TrEMBLB9R753
TrEMBLB9MVW5
TrEMBLA5AV37
TIGROs12g07730.1
TIGROs09g35730.1
TIGROs08g43320.1
TIGROs06g43080.1
TIGROs05g45380.1
TIGROs01g53940.1
TIGROs01g50460.1
SwissProtQ8GYH8
SwissProtP28777
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p01600.1 ID=Ma00_p01600.1|Name=Ma00_p01600.1|organism=Musa acuminata|type=polypeptide|length=140bp
MASIGQTSGTVVEDLYKEQQPSATSYVASGYHGCCFGAYKSFDSGFICTY
TAMAAARSSRVLQVALLVLVVGLAMSGQAASRRILEQRGGDEIIGFVGDF
LLGEIKIGRPSYGGRGHKMTTDFNTEEVKDSGPSPGIGH*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t01600.1Ma00_t01600.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_1IC_1
Vocabulary: Genedb Products
TermDefinition
Uncharacterized proteinUncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene