Overview
NameMa00_p01560.1
Unique NameMa00_p01560.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length594
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:9682243..9731580 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
NoteMa00_g01560~ Citrate transporter protein, putative, expressed~ unknown_gene~ complete
Color6
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103972867
GenbankXM_009387247.1
InterProIPR004680
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p01560.1 ID=Ma00_p01560.1|Name=Ma00_p01560.1|organism=Musa acuminata|type=polypeptide|length=595bp
MASSSFLIGNGSLLTQSLVKLRNLNSSDSTAAAVSSSAAVFAALPRRPLL
LGSSLGSQRWRRASGIARAEDKAKGSSSSSSSSPCSPLLPGKDRGDYREL
IDGSGNCDPLCSVDEVSSQDFEASYQPKTDLLKALTILATALAGAAAINH
SWVGANQDLALVLVFAIGYAGIVFEESLAFNKSGVGLLMAVCLWVIRSIG
APSTEIAVSELTHASAEVSEIVFFLLGAMTIVEIIDAHQGFKLVTDNITT
RKPRILLWVVGLVTFFLSSVLDNLTSTIVMVSLLRKLVPPSEYRKFLGAV
VVIAANAGGAWTPIGDVTTTMLWINGQISTLQTMQDLFIPSALSLAVPLA
LMSLTSEVNGTSEKQSNVLASEQMAPRGQLVFAVGIGALLFVPVFKAITG
LPPYMGMLLGLGVLWILTDAIHFGDSGRQKLKVPQALSRIDTQGVLFFLG
ILLSVSSLEAAGVLRELANYLDAHIPSVELIASAIGVVSAIIDNVPLVAA
TMGMYNLTSFPQDSEFWQLVAFCAGTGGSMLIIGSASGVAFMGMEKVDFF
WYLRKVSGFAFAGYTAGIVAYVVIHNLPFSLPTSLAELPFLSGP*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t01560.1Ma00_t01560.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Citrate transporter protein, putative, expressedCitrate transporter protein, putative, expressed
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane