Overview
NameMa00_p01490.1
Unique NameMa00_p01490.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length49
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:8359406..8359555 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT00530_001
Old locus tagGSMUA_AchrUn_randomG00530_001
NoteMa00_g01490~ Protein Ycf2~ unknown_gene~ fragment
Color6
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p01490.1 ID=Ma00_p01490.1|Name=Ma00_p01490.1|organism=Musa acuminata|type=polypeptide|length=50bp
MRRHQFKFWIVELREILREIKNSHYFLDSWIKYIFFHQERFMKLFDPRI*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t01490.1Ma00_t01490.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
fragmentfragment
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_2IC_2
Vocabulary: Genedb Products
TermDefinition
Protein Ycf2Protein Ycf2
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Cellular Component
TermDefinition
GO:0009507chloroplast
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding