Overview
NameMa00_p00170.1
Unique NameMa00_p00170.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length148
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
NoteMa00_g00170~ Uncharacterized protein At4g28440~ unknown_gene~ complete
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103978377
GenbankXM_009394153.1
InterProIPR012340
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:186112..188646 -
Relationships

This polypeptide is derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t00170.1Ma00_t00170.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p00170.1 ID=Ma00_p00170.1|Name=Ma00_p00170.1|organism=Musa acuminata|type=polypeptide|length=149bp
MATTQQRQQQQAAGGSKRKPVFTKVDQLKPGTTGHTLTAKVLTSKTVLHK
GRAGAAAADLRPIMISECLIGDETGAIVFTARNEQVELMKPGTTVILRNS
KIDMFKGSMRLAVDKWGRVEVTEPASFTVKEDNNLSIVEYELVNVAEE*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
CC_functional_completenesscomplete
Vocabulary: CC Evidence
TermDefinition
CC_evidenceautomatic
Vocabulary: CC Status
TermDefinition
CC_statusin_progress
Vocabulary: CC Evidence Code
TermDefinition
CC_evidence_codeIC_2
Vocabulary: Genedb Products
TermDefinition
genedb_productsUncharacterized protein At4g28440
Vocabulary: CC EC Number
TermDefinition
CC_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
CC_geneunknown_gene
InterPro Report