Overview
NameMa00_p00160.1
Unique NameMa00_p00160.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length348
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
NoteMa00_g00160~ Putative DnaJ protein homolog~ unknown_gene~ complete
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Owneracenci
Annotator commenteliminated second and third introns; added five prime UTR based on JV396228
OriginCIRAD:GSMUA_Achr3T15480_001
Old locus tagGSMUA_Achr3G15480_001
Color2
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ9SIL3
TrEMBLD7TJD8
TrEMBLD7L3Q0
TrEMBLC6T8E0
TrEMBLB9RVT4
TrEMBLB9RB96
TrEMBLB7FHS3
TrEMBLA2Q505
TIGROs08g28700.1
TIGROs08g06460.2
TIGROs08g06460.1
TIGROs05g48810.1
TIGROs05g03630.1
TIGROs02g20394.1
TIGROs02g03600.1
TIGROs01g13760.1
SwissProtQ9UDY4
SwissProtQ9D832
SwissProtQ80Y75
SwissProtQ5R8J8
SwissProtQ2KIT4
SwissProtP59910
SwissProtO89114
SwissProtO75953
InterProIPR018253
InterProIPR008971
InterProIPR002939
InterProIPR001623
GreenPhylGP000052
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:183582..184966 -
Relationships

This polypeptide is derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t00160.1Ma00_t00160.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p00160.1 ID=Ma00_p00160.1|Name=Ma00_p00160.1|organism=Musa acuminata|type=polypeptide|length=349bp
MGADYYKILGVDKSAKDDDLKKAYRKLAMKWHPDKNPNNKNEAEAKFKQI
SEAYEVLSDPQKRAIYDQYGEEGLKGQVPPPEANGGATFFSGGGDGPTVF
RFNPRNADDIFAEFFGFSSPLGDMGGARSNGGVRGGTRFSSGVFGDDLFG
SAFGGGVEGPMNSRRPQKAAPIENLLPCSLEELYKGTTKRMKISREIADM
SGKTMPVEEILTIDIKPGWKKGTKITFEEKGNERPNVIPADVVFIIDEKP
HPVFTREGNDLVTTKKISLAEALTGYTAHLTTLDGRSLIVPVDSVIRPGY
EEVVPKEGMPLPKDPSRKGNLRIKFDIKFPTRLTSEQKAGIKRLLPSP*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
CC_functional_completenesscomplete
Vocabulary: CC Evidence
TermDefinition
CC_evidenceautomatic
Vocabulary: CC Status
TermDefinition
CC_statusin_progress
Vocabulary: CC Evidence Code
TermDefinition
CC_evidence_codeIC_3
Vocabulary: Genedb Products
TermDefinition
genedb_productsPutative DnaJ protein homolog
Vocabulary: CC EC Number
TermDefinition
CC_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
CC_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0051082unfolded protein binding
GO:0031072heat shock protein binding
Vocabulary: Biological Process
TermDefinition
GO:0006457protein folding
InterPro Report