Overview
NameMa00_p00130.1
Unique NameMa00_p00130.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length430
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
NoteMa00_g00130~ dehydrogenase, putative, expressed~ unknown_gene~ complete
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103978388
GenbankXM_009394167.1
InterProIPR013154
InterProIPR011032
InterProIPR002085
InterProIPR020843
InterProIPR016040
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:142373..148777 +
Relationships

This polypeptide is derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t00130.1Ma00_t00130.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p00130.1 ID=Ma00_p00130.1|Name=Ma00_p00130.1|organism=Musa acuminata|type=polypeptide|length=431bp
MVVLQQLVGLDAPLACTLFSTLRGPLSLPSRAARAVSRRLAPGGWGTPAM
WQLGGHRLLAPAVGLRATSTAAVSSCRAVMLPRFGGPEVREVRPAVGVPS
LKPRDVLVRSRAVSINPLDLRMRSGYGCSIFEPLLPLIIGRDISGEVAAV
GTSVSSLTVGQEVFGALHPTAVRGTYADYAILSEDELTLKPPSATRGILG
DIYGPWYILENFVIVQDASAIPFAALTAWRALKSTARITNGQRLLVLGGG
GAVGLAAIQIAVAAGCSVSATCGSQSIERVLAFGAEQAIDYTAEDIEVAI
KGQFDAVLDTIGVPETERTGINLLKKGGHYMMLQGETASLADKYGLVIGI
PAATTILLKKQLQYRYSHGIEYWWTYMRADAEGLDEFRRLSEAGKLKIPV
EETFPIAKVRKAHEVKEKRIIPGKVVLEVD*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
CC_functional_completenesscomplete
Vocabulary: CC Evidence
TermDefinition
CC_evidenceautomatic
Vocabulary: CC Status
TermDefinition
CC_statusin_progress
Vocabulary: CC Evidence Code
TermDefinition
CC_evidence_codeIC_2
Vocabulary: Genedb Products
TermDefinition
genedb_productsdehydrogenase, putative, expressed
Vocabulary: CC EC Number
TermDefinition
CC_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
CC_geneunknown_gene
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0016491oxidoreductase activity
InterPro Report