Overview
NameMa00_p00110.2
Unique NameMa00_p00110.2
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length222
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
NoteMa00_g00110~ Ras-related protein RABA1f~ unknown_gene~ complete
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
Color6
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:122506..127358 +
Relationships

This polypeptide is derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t00110.2Ma00_t00110.2Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p00110.2 ID=Ma00_p00110.2|Name=Ma00_p00110.2|organism=Musa acuminata|type=polypeptide|length=223bp
MAYRSDDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFA
TRSIRVEDKVVKAQIWDTAGQERQTLSDRYRAITSAYYRGAVGALLVYDV
TRHTTFENVERWMKELRDHTDSSIVIMLVGNKADLRHLRAVTVEDSKAFA
ERENSFFMETSALESTNVDNAFTEVLTQIYRVTSRKALDAGDDPTTLPKG
QTINIGTHDDVSAVKKAGCCSA*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
CC_functional_completenesscomplete
Vocabulary: CC Evidence
TermDefinition
CC_evidenceautomatic
Vocabulary: CC Status
TermDefinition
CC_statusin_progress
Vocabulary: CC Evidence Code
TermDefinition
CC_evidence_codeIC_2
Vocabulary: Genedb Products
TermDefinition
genedb_productsRas-related protein RABA1f
Vocabulary: CC EC Number
TermDefinition
CC_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
CC_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
Vocabulary: Biological Process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0015031protein transport
GO:0006886intracellular protein transport
GO:0006913nucleocytoplasmic transport
GO:0007165signal transduction
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular
GO:0016020membrane
InterPro Report