Overview
NameMa00_p00100.1
Unique NameMa00_p00100.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length183
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
NoteMa00_g00100~ Putative Ethylene-responsive transcription factor 2~ unknown_gene~ fragment
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Owneracenci
Annotator commenteliminated two exons; added five prime and three prime UTRs
OriginCIRAD:GSMUA_Achr3T15550_001
Old locus tagGSMUA_Achr3G15550_001
Color2
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLD7TJG5
TrEMBLD3Y3F3
TrEMBLD0U263
TrEMBLC0PQI3
TrEMBLB9S948
TrEMBLB9H2N1
TrEMBLA9NRQ5
TrEMBLA5CAD4
TIGROs09g39810.1
TIGROs04g46250.1
TIGROs04g46220.1
TIGROs04g18650.1
TIGROs03g64260.1
TIGROs02g43820.1
TIGROs02g43790.1
TIGROs01g54890.1
SwissProtQ9LW50
SwissProtQ8LDC8
SwissProtQ8L9K1
SwissProtQ84XB3
SwissProtQ40479
SwissProtO80338
SwissProtO80337
SwissProtO04681
InterProIPR016177
InterProIPR001471
GreenPhylGP000017
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:114816..115367 -
Relationships

This polypeptide is derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t00100.1Ma00_t00100.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p00100.1 ID=Ma00_p00100.1|Name=Ma00_p00100.1|organism=Musa acuminata|type=polypeptide|length=184bp
MRIMAGDEDCTQTQLPFNENDSQDVVLFEVLREASAGPPPPPPLPSSSST
SDDSGSGPARRRAGKYRGVRRRPWGKFAAEIRDSSRHGARLWLGTFDTAE
AAAIAYDRAAFRMRGSKALLNFPLAIALASGAPAVGRQRIAQGGSDAVPS
TVEPQNPRPDHSAGLLEASKAGESTKSVLNRQL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
CC_functional_completenessfragment
Vocabulary: CC Evidence
TermDefinition
CC_evidenceautomatic
Vocabulary: CC Status
TermDefinition
CC_statusin_progress
Vocabulary: CC Evidence Code
TermDefinition
CC_evidence_codeIC_3
Vocabulary: Genedb Products
TermDefinition
genedb_productsPutative Ethylene-responsive transcription factor 2
Vocabulary: CC EC Number
TermDefinition
CC_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
CC_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0003700sequence-specific DNA binding transcription factor activity
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro Report