Overview
NameMa00_p00090.1
Unique NameMa00_p00090.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length271
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:113662..114477 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
NoteMa00_g00090~ Putative Uncharacterized protein~ unknown_gene~ complete
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Owneracenci
Annotator commentcompletely reannotated
OriginCIRAD:GSMUA_Achr3T15560_001
Old locus tagGSMUA_Achr3G15560_001
Color2
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLB9SZX0
TrEMBLB9H2N0
TIGROs07g22770.1
TIGROs07g22730.1
TIGROs03g64260.1
SwissProtO49515
InterProIPR001471
InterProIPR016177
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p00090.1 ID=Ma00_p00090.1|Name=Ma00_p00090.1|organism=Musa acuminata|type=polypeptide|length=272bp
MLYRLLCDSTSQLLFNPKRLLSSTTLMEKKSESNQMLLENVWASFINGSH
RPAIGSATWEDLPNLESRNENLALIQRLPSLGRWISMGAETWEELLDGTC
SVSNCSPTPATESARSTRPTAAGAERETTRHYRGVRRRPWGKFAAEIRDI
SRKGARVWLGTFNTAEEAAIAYDRAALRMRGPRAHLNFPLETAIRSSKST
RYEQPSTCALCDEACSVYGCTAAIHERADLDEERPACRRERSIEGMINNR
RDVVELQDLGTDYLESLLSQE*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t00090.1Ma00_t00090.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_3IC_3
Vocabulary: Genedb Products
TermDefinition
Putative Uncharacterized proteinPutative Uncharacterized protein
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0003700sequence-specific DNA binding transcription factor activity
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated