Overview
NameMa00_p00070.1
Unique NameMa00_p00070.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length444
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:80840..82327 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
DateTue Dec 7 21:17:29 CET 2010
Inference{gaze}
Alternative splicingto_fill
Ownermusa
Annotator commentto_fill
OriginCIRAD:GSMUA_AchrUn_randomT17970_001
Old locus tagGSMUA_AchrUn_randomG17970_001
NoteMa00_g00070~ Putative UDP-glycosyltransferase 73B4~ unknown_gene~ complete
Color6
Cross References
External references for this polypeptide
DatabaseAccession
TrEMBLQ7Y232
TrEMBLD7L3M2
TrEMBLB9RYD4
TrEMBLB9NG81
TrEMBLB9HS33
TrEMBLB9GHC3
TrEMBLB9GHB7
TrEMBLB9GHB6
TIGROs03g59350.1
TIGROs03g53350.1
TIGROs01g45140.1
TIGROs01g45110.1
TIGROs01g41430.1
TIGROs01g08110.1
TIGROs01g08100.1
TIGROs01g08090.1
SwissProtQ9ZQ99
SwissProtQ9ZQ95
SwissProtQ9ZQ94
SwissProtQ9AR73
SwissProtQ8H0F2
SwissProtQ4R1I9
SwissProtP56725
SwissProtO48676
InterProIPR002213
GreenPhylGP000106
Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p00070.1 ID=Ma00_p00070.1|Name=Ma00_p00070.1|organism=Musa acuminata|type=polypeptide|length=445bp
MGSVEAPPAPLRVFFIPFFATGHMIPLVDIARLFAARGVDSTVLVTPANA
ALIQATVDAAADSGLPIRTLIYPFPSSESGLPPGVENISALPPSESYKID
VATPFVRPAHDRLLRLHRPDAVVADVHFPWTTFVARDLGVPRFTFQALGL
FPVCMMNSLFTNLPHLAVAGDDVPFLVPNLPHPIHMSGSLGVVVNSFVEM
ESAYAEYYYKTCNMRSWFVGPVALAAAGQGSSLATRGGDDPIAAANRARC
LLWLDAKEPKSAAGHPFLWVVRDGSDEWMPEGFERRVEGRGLVVRGWAPQ
VAILAHAAVGGFVTHCGWNSVLEGVSAGLPMVTWPLSTEQFMNEKLVVGV
LRVGVRAAEGPGSTLEEERAVVGAAELARAVGWVMDSGEEAERMRRRARE
YGETARAAVKEGGSSHKGLSDLIEEIRAWHSNKDVACDAATLKD*
back to top
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t00070.1Ma00_t00070.1Musa acuminatamRNA


Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
completecomplete
Vocabulary: CC Evidence
TermDefinition
automaticautomatic
Vocabulary: CC Status
TermDefinition
in_progressin_progress
Vocabulary: CC Evidence Code
TermDefinition
IC_3IC_3
Vocabulary: Genedb Products
TermDefinition
Putative UDP-glycosyltransferase 73B4Putative UDP-glycosyltransferase 73B4
Vocabulary: CC EC Number
TermDefinition
no_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
unknown_geneunknown_gene
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0016758transferase activity, transferring hexosyl groups