Overview
NameMa00_p00010.1
Unique NameMa00_p00010.1
Typepolypeptide
OrganismMusa acuminata (musa)
Sequence length612
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
manual_curation2015-04-05 .281687
Properties
Property NameValue
Ownermusa
Annotator commentto_fill
Inference{refseq}
Alternative splicingto_fill
NoteMa00_g00010~ Mitogen-activated protein kinase 10~ unknown_gene~ complete
Color6
Cross References
External references for this polypeptide
DatabaseAccession
GeneID103974351
GenbankXM_009389157.1
EC2.7.11.24
EC2.7.11.1
InterProIPR017441
InterProIPR002290
InterProIPR000719
InterProIPR003527
InterProIPR011009
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chrUn_randomchromosomechrUn_random:6544..13101 +
Relationships

This polypeptide is derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Ma00_t00010.1Ma00_t00010.1Musa acuminatamRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Ma00_p00010.1 ID=Ma00_p00010.1|Name=Ma00_p00010.1|organism=Musa acuminata|type=polypeptide|length=613bp
MQQDQRKKNSPELDFFSEYGDANRYKIQEVIGKGSYGVVCSAIDTHTGQK
VAIKRIHDIFGHISDAVRILREIKLLRLLRHPDIVEIKHIILPLSRRDFN
DIYVVFELMESDLHQVIKANDDLTREHYRFFLYQLLRALKYIHTANVYHR
DLKPKNILANANCKLKICDFGLARVAFGDTPTTIFWTDYVATRWYRAPEL
CGSFFSKYTAAIDIWSIGCIFAEVLTSKPLFPGKNVVHQLDLMTDLLGTP
SLDTISRVRNEKARRYLSCMRKKQSVPLAQKFPNADPLALKLLERLLSFD
PSKRPTAEEALADPYFKGLAKIEREPSCQSITKMEFEFECRRLTKEDVQE
LIFLEILEYHPQLLKDKVNGTEKTNFLYPSAVDQFRKQFAYLEENGGKSG
FGIPLDRKHVSLPRSTVVHSTTIPSLEQPNMGSSRDGPAHKNSRDIGRSS
GRIARASQAPQRIPTARPGKVVGPIMPKESGSMKDAYDRRRFTRNPVLPV
EPAIPPYCFHSTTGRSENSHRDPIDAERERGPIHHRPSQPGMTSKLTPDI
ALDTRAAPFYLAGPKADSAERNTMEANVLQAKSPFNGIVTAAGGGGGHRK
VGTLQFGMARMY*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: CC Functional Completeness
TermDefinition
CC_functional_completenesscomplete
Vocabulary: CC Evidence
TermDefinition
CC_evidenceautomatic
Vocabulary: CC Status
TermDefinition
CC_statusin_progress
Vocabulary: CC Evidence Code
TermDefinition
CC_evidence_codeIC_2
Vocabulary: Genedb Products
TermDefinition
genedb_productsMitogen-activated protein kinase 10
Vocabulary: CC EC Number
TermDefinition
CC_EC_numberno_EC_number
Vocabulary: CC Gene
TermDefinition
CC_geneunknown_gene
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004707MAP kinase activity
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
InterPro Report